Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50079939
Substrate/Competitorn/a
Meas. Tech.ChEMBL_62434
Ki 1.6±n/a nM
Citation Birch AMBradley PAGill JCKerrigan FNeedham PL N-Substituted (2,3-dihydro-1,4-benzodioxin-2-yl)methylamine derivatives as D(2) antagonists/5-HT(1A) partial agonists with potential as atypical antipsychotic agents. J Med Chem 42:3342-55 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079939
n/a
NameBDBM50079939
Synonyms:(7-Chloro-2,3-dihydro-benzo[1,4]dioxin-2-ylmethyl)-[1-(2-methoxy-phenyl)-piperidin-4-ylmethyl]-amine | CHEMBL418854
TypeSmall organic molecule
Emp. Form.C22H27ClN2O3
Mol. Mass.402.914
SMILESCOc1ccccc1N1CCC(CNCC2COc3ccc(Cl)cc3O2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: