Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM50079939
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3657
Ki>500±n/a nM
Citation Birch AMBradley PAGill JCKerrigan FNeedham PL N-Substituted (2,3-dihydro-1,4-benzodioxin-2-yl)methylamine derivatives as D(2) antagonists/5-HT(1A) partial agonists with potential as atypical antipsychotic agents. J Med Chem 42:3342-55 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR6
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | ST-B17 | Serotonin 6 (5-HT6) receptor | Serotonin receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:46945.51
Organism:RAT
Description:5-HT6 HTR6 RAT::P31388
Residue:436
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIVLICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTPAPGQC
RLLASLPFVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTAGQALETLQVP
RTPRPGMESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPPPPCGPLTAVP
DQASACSRCCLCLCRQTQIQTPLQGAPRACSSQPSFCCLERPPGTPRHPPGPPLWSTSLS
QTLWSLRYGRIHSVPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079939
n/a
NameBDBM50079939
Synonyms:(7-Chloro-2,3-dihydro-benzo[1,4]dioxin-2-ylmethyl)-[1-(2-methoxy-phenyl)-piperidin-4-ylmethyl]-amine | CHEMBL418854
TypeSmall organic molecule
Emp. Form.C22H27ClN2O3
Mol. Mass.402.914
SMILESCOc1ccccc1N1CCC(CNCC2COc3ccc(Cl)cc3O2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: