| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50080117 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157695 |
|---|
| Ki | 0.011000±n/a nM |
|---|
| Citation |  Kaltenbach, RF; Klabe, RM; Cordova, BC; Seitz, SP Increased antiviral activity of cyclic urea HIV protease inhibitors by modifying the P1/P1' substituents. Bioorg Med Chem Lett9:2259-62 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50080117 |
|---|
| n/a |
|---|
| Name | BDBM50080117 |
|---|
| Synonyms: | (4R,5S,6S,7R)-1,3-Bis-(3-amino-1H-indazol-5-ylmethyl)-5,6-dihydroxy-4,7-bis-(3-methyl-benzyl)-[1,3]diazepan-2-one | CHEMBL70626 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H40N8O3 |
|---|
| Mol. Mass. | 644.7653 |
|---|
| SMILES | Cc1cccc(C[C@@H]2[C@H](O)[C@@H](O)[C@@H](Cc3cccc(C)c3)N(Cc3ccc4[nH]nc(N)c4c3)C(=O)N2Cc2ccc3[nH]nc(N)c3c2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
