Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFolylpoly-gamma-glutamate synthetase
LigandBDBM50080449
Substrate/Competitorn/a
Meas. Tech.ChEMBL_68520
Ki 110000±n/a nM
Citation Rosowsky AForsch RANull AMoran RG 5-deazafolate analogues with a rotationally restricted glutamate or ornithine side chain: synthesis and binding interaction with folylpolyglutamate synthetase. J Med Chem 42:3510-9 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Folylpoly-gamma-glutamate synthetase
Name:Folylpoly-gamma-glutamate synthetase
Synonyms:FPGS | Folylpolyglutamate synthase, mitochondrial | Tetrahydrofolate synthase | Tetrahydrofolylpolyglutamate synthase
Type:PROTEIN
Mol. Mass.:64621.95
Organism:Homo sapiens (Human)
Description:ChEMBL_68676
Residue:587
Sequence:
MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAG
YLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRS
YGLKTGFFSSPHLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGE
HQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEW
PGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEE
QASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSP
PKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080449
n/a
NameBDBM50080449
Synonyms:(S)-5-Amino-2-{5-[(2-amino-4-oxo-3,4-dihydro-pyrido[2,3-d]pyrimidin-6-ylmethyl)-amino]-1-oxo-1,3-dihydro-isoindol-2-yl}-pentanoic acid | CHEMBL117462
TypeSmall organic molecule
Emp. Form.C21H23N7O4
Mol. Mass.437.4518
SMILESNCCC[C@H](N1Cc2cc(NCc3cnc4nc(N)[nH]c(=O)c4c3)ccc2C1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: