| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM1163 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157724 (CHEMBL763397) |
|---|
| Ki | 19±n/a nM |
|---|
| Citation |  Hultén, J; Andersson, HO; Schaal, W; Danielson, HU; Classon, B; Kvarnström, I; Karlén, A; Unge, T; Samuelsson, B; Hallberg, A Inhibitors of the C(2)-symmetric HIV-1 protease: nonsymmetric binding of a symmetric cyclic sulfamide with ketoxime groups in the P2/P2' side chains. J Med Chem42:4054-61 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM1163 |
|---|
| n/a |
|---|
| Name | BDBM1163 |
|---|
| Synonyms: | (3R,4S,5S,6R)-2,7-Dibenzyl-3,6-bis(phenoxymethyl)-4,5-dihydroxy-1,2,7-thiadiazepan 1,1-Dioxide | (3R,4S,5S,6R)-2,7-dibenzyl-4,5-dihydroxy-3,6-bis(phenoxymethyl)-1,2,7-thiadiazepane-1,1-dione | CHEMBL130998 | Cyclic Sulfamide 4 | Cyclic Sulfamide deriv. 19 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H34N2O6S |
|---|
| Mol. Mass. | 574.687 |
|---|
| SMILES | O[C@@H]1[C@@H](O)[C@@H](COc2ccccc2)N(Cc2ccccc2)S(=O)(=O)N(Cc2ccccc2)[C@@H]1COc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
