Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosyl-tRNA synthetase
LigandBDBM50081840
Substrate/Competitorn/a
Meas. Tech.ChEBML_211021
IC50 3800±n/a nM
Citation Jarvest RLBerge JMHouge-Frydrych CSJanson CMensah LMO'Hanlon PJPope ASaldanha AQiu X Interaction of tyrosyl aryl dipeptides with S. aureus tyrosyl tRNA synthetase: inhibition and crystal structure of a complex. Bioorg Med Chem Lett 9:2859-62 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosyl-tRNA synthetase
Name:Tyrosyl-tRNA synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:59145.78
Organism:Homo sapiens (Human)
Description:ChEMBL_211030
Residue:528
Sequence:
MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIA
DFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKG
TDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVD
AQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKED
VKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFA
AEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEP
EEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEE
LKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081840
n/a
NameBDBM50081840
Synonyms:(S)-2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-3-(4-hydroxy-phenyl)-propionic acid | CHEMBL95286 | Tyr-Tyr
TypeSmall organic molecule
Emp. Form.C18H20N2O5
Mol. Mass.344.3618
SMILESN[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: