| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50082398 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79472 |
|---|
| Ki | 0.250000±n/a nM |
|---|
| Citation |  Patel, M; Rodgers, JD; McHugh, RJ; Johnson, BL; Cordova, BC; Klabe, RM; Bacheler, LT; Erickson-Viitanen, S; Ko, SS Unsymmetrical cyclic ureas as HIV-1 protease inhibitors: novel biaryl indazoles as P2/P2' substituents. Bioorg Med Chem Lett9:3217-20 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50082398 |
|---|
| n/a |
|---|
| Name | BDBM50082398 |
|---|
| Synonyms: | (4R,5S,6S,7R)-1-(3-Amino-benzyl)-4,7-dibenzyl-5,6-dihydroxy-3-[3-(4-trifluoromethyl-phenyl)-1H-indazol-5-ylmethyl]-[1,3]diazepan-2-one | CHEMBL323449 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H38F3N5O3 |
|---|
| Mol. Mass. | 705.7673 |
|---|
| SMILES | Nc1cccc(CN2[C@H](Cc3ccccc3)[C@H](O)[C@@H](O)[C@@H](Cc3ccccc3)N(Cc3ccc4[nH]nc(-c5ccc(cc5)C(F)(F)F)c4c3)C2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
