Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50082827
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33740
Ki 0.06±n/a nM
Citation Murali Dhar TGNagarathnam DMarzabadi MRLagu BWong WCChiu GTyagarajan SMiao SWZhang FSun WTian DShen QZhang JWetzel JMForray CChang RSBroten TPSchorn TWChen TBO'Malley SRansom RSchneck KBendesky RHarrell CMVyas KP Design and synthesis of novel alpha(1)(a) adrenoceptor-selective antagonists. 2. Approaches to eliminate opioid agonist metabolites via modification of linker and 4-methoxycarbonyl-4-phenylpiperidine moiety. J Med Chem 42:4778-93 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha-1A adrenergic receptor
Synonyms:ADRA1A | ADRA1C | Adrenergic alpha1A | Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha adrenergic receptor 1a | Alpha-1C adrenergic receptor | Alpha-adrenergic receptor 1c | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1 | adrenergic Alpha1C
Type:Cell-surface receptors
Mol. Mass.:51511.67
Organism:Homo sapiens (Human)
Description:P35348
Residue:466
Sequence:
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50082827
n/a
NameBDBM50082827
Synonyms:4-(3,4-Difluoro-phenyl)-6-methyl-2-oxo-3-[3-(4-o-tolyl-4-p-tolyl-piperidin-1-yl)-propylcarbamoyl]-1,2,3,4-tetrahydro-pyrimidine-5-carboxylic acid methyl ester | CHEMBL145894
TypeSmall organic molecule
Emp. Form.C36H40F2N4O4
Mol. Mass.630.724
SMILESCOC(=O)C1=C(C)NC(=O)N(C1c1ccc(F)c(F)c1)C(=O)NCCCN1CCC(CC1)(c1ccc(C)cc1)c1ccccc1C |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: