Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50085041
Substrate/Competitorn/a
Meas. Tech.ChEMBL_139147
EC50 3800±n/a nM
Citation Willson TMBrown PJSternbach DDHenke BR The PPARs: from orphan receptors to drug discovery. J Med Chem 43:527-50 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085041
n/a
NameBDBM50085041
Synonyms:2-(4-(3-(4-acetyl-3-hydroxy-2-propylphenoxy)propoxy)phenoxy)acetic acid | CHEMBL153057 | L-165041 | L165041 | {4-[3-(4-Acetyl-3-hydroxy-2-propyl-phenoxy)-propoxy]-phenoxy}-acetic acid(L-165041) | {4-[3-(4-acetyl-3-hydroxy-2-propylphenoxy)propoxy]phenoxy}acetic acid
TypeSmall organic molecule
Emp. Form.C22H26O7
Mol. Mass.402.4376
SMILESCCCc1c(O)c(ccc1OCCCOc1ccc(OCC(O)=O)cc1)C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: