Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50085751
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71751
Ki 0.35±n/a nM
Citation Rivier JEPorter JCervini LALahrichi SLKirby DAStruthers RSKoerber SCRivier CL Design of monocyclic (1-3) and dicyclic (1-3/4-10) gonadotropin releasing hormone (GnRH) antagonists. J Med Chem 43:797-806 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085751
n/a
NameBDBM50085751
Synonyms:CHEMBL437230 | cyclo(1,1'-3)Ac-D-Asp (beta-Ala)-D-Cpa-D-Dpr-Ser-Tyr-D-Nal-Leu-Arg-Pro-D-Ala-NH2
TypeSmall organic molecule
Emp. Form.C66H87ClN16O15
Mol. Mass.1379.948
SMILESCC(C)C[C@@H](NC(=O)C(Cc1ccc2ccccc2c1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H]1CNC(=O)[C@@H](Cc2ccc(Cl)cc2)NC(=O)C(CC(=O)NCCC(=O)N1)NC(C)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@@H]1C(=O)NC(C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: