Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50085791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71743
Ki 0.15±n/a nM
Citation Rivier JEJiang GStruthers RSKoerber SCPorter JCervini LAKirby DACraig AGRivier CL Design of potent dicyclic (1-5/4-10) gonadotropin releasing hormone (GnRH) antagonists. J Med Chem 43:807-18 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085791
n/a
NameBDBM50085791
Synonyms:CHEMBL265240 | Gonadotropin Releasing Hormone analogue
TypeSmall organic molecule
Emp. Form.C70H89ClN18O14
Mol. Mass.1442.021
SMILESCC(C)C[C@H]1NC(=O)[C@@H](Cc2ccc3ccccc3c2)NC(=O)[C@H]2CCNC(=O)CCNC(=O)C[C@@H](NC(C)=O)C(=O)N[C@@H](Cc3ccc(Cl)cc3)C(=O)N[C@H](Cc3c[nH]c4ccccc34)C(=O)N[C@H](CC(=O)NC[C@@H](NC(=O)[C@H]3CCCN3C(=O)[C@H](CCCNC(N)=N)NC1=O)C(N)=O)C(=O)N2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: