| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP1 subtype |
|---|
| Ligand | BDBM50035622 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158172 (CHEMBL766135) |
|---|
| IC50 | 380±n/a nM |
|---|
| Citation |  Wang, Y; Wos, JA; Dirr, MJ; Soper, DL; deLong, MA; Mieling, GE; De, B; Amburgey, JS; Suchanek, EG; Taylor, CJ Design and synthesis of 13,14-dihydro prostaglandin F(1alpha) analogues as potent and selective ligands for the human FP receptor. J Med Chem43:945-52 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP1 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP1 subtype |
|---|
| Synonyms: | PE2R1_HUMAN | PGE receptor, EP1 subtype | PTGER1 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP1 subtype | Prostaglandin E2 receptor EP1 subtype (EP1) | Prostanoid EP1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41834.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34995 |
|---|
| Residue: | 402 |
|---|
| Sequence: | MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
|
|
|
|---|
| BDBM50035622 |
|---|
| n/a |
|---|
| Name | BDBM50035622 |
|---|
| Synonyms: | (5Z,13E,15S)-9alpha,11alpha,15-trihydroxyprosta-5,13-dien-1-oic acid | CHEMBL815 | DINOPROST | PGF2alpha | l-PGF2-alpha | l-Prostaglandin F2-alpha | prostaglandin F2alpha |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H34O5 |
|---|
| Mol. Mass. | 354.481 |
|---|
| SMILES | CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)C[C@H](O)[C@@H]1C\C=C/CCCC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
