Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50087677
Substrate/Competitorn/a
Meas. Tech.ChEBML_99644
IC50>10000±n/a nM
Citation Durand DHullot PVidal JPGirard JPBanères JLParello JMuller ABonne CRossi JC Leukotriene B4 photoaffinity probes: design, synthesis and evaluation of new arylazide-1,3-disubstituted cyclohexanes. Bioorg Med Chem Lett 10:811-4 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087677
n/a
NameBDBM50087677
Synonyms:2-{3-[(E)-7-(4-Azido-3-iodo-phenyl)-3-hydroxy-hept-1-enyl]-1-hydroxy-cyclohexyl}-N,N-dimethyl-acetamide | CHEMBL352717
TypeSmall organic molecule
Emp. Form.C23H33IN4O3
Mol. Mass.540.4376
SMILESCN(C)C(=O)CC1(O)CCCC(C1)\C=C\C(O)CCCCc1ccc(N=[N+]=[N-])c(I)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: