Reaction Details |
| Report a problem with these data |
Target | Leukotriene B4 receptor 1 |
---|
Ligand | BDBM50087678 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_99644 |
---|
IC50 | >10000±n/a nM |
---|
Citation | Durand, D; Hullot, P; Vidal, JP; Girard, JP; Banères, JL; Parello, J; Muller, A; Bonne, C; Rossi, JC Leukotriene B4 photoaffinity probes: design, synthesis and evaluation of new arylazide-1,3-disubstituted cyclohexanes. Bioorg Med Chem Lett10:811-4 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Leukotriene B4 receptor 1 |
---|
Name: | Leukotriene B4 receptor 1 |
Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37582.68 |
Organism: | Homo sapiens (Human) |
Description: | Q15722 |
Residue: | 352 |
Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
BDBM50087678 |
---|
n/a |
---|
Name | BDBM50087678 |
Synonyms: | CHEMBL168507 | Sodium; {3-[(E)-7-(4-azido-3-iodo-phenyl)-3-hydroxy-hept-1-enyl]-1-hydroxy-cyclohexyl}-acetate |
Type | Small organic molecule |
Emp. Form. | C21H28IN3O4 |
Mol. Mass. | 513.3692 |
SMILES | OC(CCCCc1ccc(N=[N+]=[N-])c(I)c1)\C=C\C1CCCC(O)(CC(O)=O)C1 |
Structure |
|