Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman rhinovirus A protease
LigandBDBM50087780
Substrate/Competitorn/a
Meas. Tech.ChEMBL_160905
Ki 400±n/a nM
Citation Reich SHJohnson TWallace MBKephart SEFuhrman SAWorland STMatthews DAHendrickson TFChan FMeador JFerre RABrown ELDeLisle DMPatick AKBinford SLFord CE Substituted benzamide inhibitors of human rhinovirus 3C protease: structure-based design, synthesis, and biological evaluation. J Med Chem 43:1670-83 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human rhinovirus A protease
Name:Human rhinovirus A protease
Synonyms:Human rhinovirus B 3A protease
Type:PROTEIN
Mol. Mass.:44361.04
Organism:Human rhinovirus B
Description:ChEMBL_158953
Residue:401
Sequence:
AFRPCNVNTKIGNAKCCPFVCGKAVTFKDRSTCSTYNLSSSLHHILEEDKRRRQVVDVMS
AIFQGPISLDAPPPPAIADLLQSVRTPRVIKYCQIIMGHPAECQVERDLNIANSIIAIIA
NIISIAGIIFVIYKLFCSLQGPYSGEPKPKTKVPERRVVAQGPEEEFGRSILKNNTCVIT
TGNGKFTGLGIHDRILIIPTHADPGREVQVNGVHTKVLDSYDLYNRDGVKLEITVIQLDR
NEKFRDIRKYIPETEDDYPECNLALSANQDEPTIIKVGDVVSYGNILLSGNQTARMLKYN
YPTKSGYCGGVLYKIGQILGIHVGGNGRDGFSAMLLRSYFTGQIKVNKHATECGLPDIQT
IHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLEVNFKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087780
n/a
NameBDBM50087780
Synonyms:3-(3-Oxo-3-phenyl-propenyl)-benzamide | CHEMBL294981
TypeSmall organic molecule
Emp. Form.C16H13NO2
Mol. Mass.251.2799
SMILESNC(=O)c1cccc(\C=C\C(=O)c2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: