Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50088370 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147040 (CHEMBL753343) |
---|
Ki | >10000±n/a nM |
---|
Citation | Vianello, P; Albinati, A; Pinna, GA; Lavecchia, A; Marinelli, L; Borea, PA; Gessi, S; Fadda, P; Tronci, S; Cignarella, G Synthesis, molecular modeling, and opioid receptor affinity of 9, 10-diazatricyclo[4.2.1.1(2,5)]decanes and 2,7-diazatricyclo[4.4.0. 0(3,8)]decanes structurally related to 3,8-diazabicyclo[3.2. 1]octanes. J Med Chem43:2115-23 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50088370 |
---|
n/a |
---|
Name | BDBM50088370 |
Synonyms: | 1-{10-[3-(4-Nitro-phenyl)-allyl]-9,10-diaza-tricyclo[4.2.1.1*2,5*]dec-9-yl}-propan-1-one | CHEMBL304679 |
Type | Small organic molecule |
Emp. Form. | C20H25N3O3 |
Mol. Mass. | 355.4308 |
SMILES | CCC(=O)N1C2CC[C@H]1[C@@H]1CCC2N1C\C=C\c1ccc(cc1)[N+]([O-])=O |TLB:2:4:13:11.10,11:12:4:6.7,10:9:4:6.7,THB:14:13:4.5.8:11.10,14:13:4:6.7,6:5:13:11.10,7:8:13:11.10| |
Structure |
|