Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50088657
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209065
Ki 0.240000±n/a nM
Citation Coburn CARush DMWilliams PDHomnick CLyle EALewis SDLucas BJDi Muzio-Mower JMJuliano MKrueger JAVastag KChen IWVacca JP Bicyclic pyridones as potent, efficacious and orally bioavailable thrombin inhibitors. Bioorg Med Chem Lett 10:1069-72 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088657
n/a
NameBDBM50088657
Synonyms:CHEMBL11181 | N-(6-Amino-2-methyl-pyridin-3-ylmethyl)-2-((R)-3-isobutyl-3,6-dimethyl-2,8-dioxo-2,3,4,8-tetrahydro-1H-[1,7]naphthyridin-7-yl)-acetamide
TypeSmall organic molecule
Emp. Form.C23H31N5O3
Mol. Mass.425.5239
SMILESCC(C)C[C@]1(C)Cc2cc(C)n(CC(=O)NCc3ccc(N)nc3C)c(=O)c2NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: