| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50089096 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_63966 |
|---|
| Ki | 270000±n/a nM |
|---|
| Citation |  Wright, PA; Rostom, AA; Robinson, CV; Schofield, CJ Mass spectrometry reveals elastase inhibitors from the reactive centre loop of alpha1-antitrypsin. Bioorg Med Chem Lett10:1219-21 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50089096 |
|---|
| n/a |
|---|
| Name | BDBM50089096 |
|---|
| Synonyms: | CHEMBL278549 | Met-Phe-Leu-Glu-Ala-Ile-Pro-Met | ent-Met-Phe-Leu-Glu-Ala-Ile-Pro-Met |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H70N8O11S2 |
|---|
| Mol. Mass. | 951.204 |
|---|
| SMILES | CC[C@@H](C)[C@@H](NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](Cc1ccccc1)NC(=O)[C@H](N)CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
