Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde reductase
LigandBDBM16312
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31306
IC50 5400±n/a nM
Citation Oka MMatsumoto YSugiyama STsuruta NMatsushima M A potent aldose reductase inhibitor, (2S,4S)-6-fluoro-2', 5'-dioxospiro[chroman-4,4'-imidazolidine]-2-carboxamide (Fidarestat): its absolute configuration and interactions with the aldose reductase by X-ray crystallography. J Med Chem 43:2479-83 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aldehyde reductase
Name:Aldehyde reductase
Synonyms:Alcohol dehydrogenase [NADP+] | Aldehyde Reductase (ALR1) | Aldo-keto reductase family 1 member A1
Type:Enzyme
Mol. Mass.:36574.11
Organism:Homo sapiens (Human)
Description:n/a
Residue:325
Sequence:
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16312
n/a
NameBDBM16312
Synonyms:(4S)-6-fluoro-2,3-dihydrospiro[1-benzopyran-4,4'-imidazolidine]-2',5'-dione | CHEMBL266497 | Sorbinil
TypeSmall organic molecule
Emp. Form.C11H9FN2O3
Mol. Mass.236.1992
SMILESFc1ccc2OCC[C@]3(NC(=O)NC3=O)c2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: