Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAICAR transformylase
LigandBDBM50089572
Substrate/Competitorn/a
Meas. Tech.ChEBML_32812
Ki 17000±n/a nM
Citation Boger DLMarsilje THCastro RAHedrick MPJin QBaker SJShim JHBenkovic SJ Design, synthesis, and biological evaluation of fluoronitrophenyl substituted folate analogues as potential inhibitors of GAR transformylase and AICAR transformylase. Bioorg Med Chem Lett 10:1471-5 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
AICAR transformylase
Name:Thymidylate synthase/GAR transformylase/AICAR transformylase
Synonyms:5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase | 5-aminoimidazole-4-carboxamide-ribonucleotide transformylase | ATIC | Aminoimidazole carboxamide ribonucleotide transformylase (AICAR Tfase) | Bifunctional purine biosynthesis protein PURH | IMP cyclohydrolase | IMP synthetase | Inosinicase | Phosphoribosylaminoimidazolecarboxamide formyltransferase
Type:Protein
Mol. Mass.:64616.62
Organism:Homo sapiens (Human)
Description:P31939
Residue:592
Sequence:
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT
HTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL
CDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPIS
AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT
GVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDA
FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50089572
n/a
NameBDBM50089572
Synonyms:2-{4-[(2-Amino-4-oxo-3,4-dihydro-quinazolin-6-ylmethyl)-(4-fluoro-3-nitro-benzyl)-amino]-benzoylamino}-pentanedioic acid | CHEMBL286459
TypeSmall organic molecule
Emp. Form.C28H25FN6O8
Mol. Mass.592.5319
SMILESNc1nc2ccc(CN(Cc3ccc(F)c(c3)[N+]([O-])=O)c3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)cc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: