Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTubulin
LigandBDBM50005480
Substrate/Competitorn/a
Meas. Tech.ChEMBL_225983
IC50 1000±n/a nM
Citation Pettit GRGrealish MPHerald DLBoyd MRHamel EPettit RK Antineoplastic agents. 443. Synthesis of the cancer cell growth inhibitor hydroxyphenstatin and its sodium diphosphate prodrug. J Med Chem 43:2731-7 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tubulin
Name:Tubulin
Synonyms:Tubulin alpha chain | Tubulin alpha-1A chain
Type:Protein
Mol. Mass.:50049.25
Organism:Sus scrofa (Pig)
Description:P02550
Residue:451
Sequence:
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005480
n/a
NameBDBM50005480
Synonyms:(-)-combretastatin | (Z)-3'-hydroxy-3,4,4',5-tetramethoxystilbene | (Z)-5-(3,4,5-trimethoxystyryl)-2-methoxyphenol | (combretastatin A-4)2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | (combretastin A-4)2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-Methoxy-5-[(Z)-2-(3,4,5-trimethox y-phenyl)-vinyl]-phenol | 2-Methoxy-5-[(Z)-2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-methoxy-5-(3,4,5-trimethoxystyryl)phenol | 2-methoxy-5-[(Z)-2-(3,4,5-trimethoxyphenyl)vinyl]phenol | 5-(3,4,5-trimethoxystyryl)-2-methoxyphenol | 5-[(S)-2-Hydroxy-2-(3,4,5-trimethoxy-phenyl)-ethyl]-2-methoxy-phenol | CHEMBL67 | Combrestatin A-4 | Combrestatin A4 | Combretastastin A-4 | Combretastatin | Combretastatin-A4 | Combretastin A-4 | Z-Combretastatin A-4 | combretastatin A-4, (CSA4) | combretastin A4
TypeSmall organic molecule
Emp. Form.C18H20O5
Mol. Mass.316.3484
SMILESCOc1ccc(\C=C/c2cc(OC)c(OC)c(OC)c2)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: