Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D
LigandBDBM50090647
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1711
Ki>500±n/a nM
Citation Lagu BTian DJeon YLi CWetzel JMNagarathnam DShen QForray CChang RSBroten TPRansom RWChan TBO'Malley SSSchorn TWRodrigues ADKassahun KPettibone DJFreidinger ROGluchowski C De novo design of a novel oxazolidinone analogue as a potent and selective alpha1A adrenergic receptor antagonist with high oral bioavailability. J Med Chem 43:2775-8 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1D
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | Serotonin Receptor 1D
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41920.63
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:377
Sequence:
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090647
n/a
NameBDBM50090647
Synonyms:(4S,5S)-4-(3,4-Difluoro-phenyl)-5-methyl-2-oxo-oxazolidine-3-carboxylic acid {3-[4-(4-fluoro-phenyl)-piperidin-1-yl]-propyl}-amide | (4S,5S)-4-(3,4-difluorophenyl)-N-(3-(4-(4-fluorophenyl)piperidin-1-yl)propyl)-5-methyl-2-oxooxazolidine-3-carboxamide | 4-(3,4-Difluoro-phenyl)-5-methyl-2-oxo-oxazolidine-3-carboxylic acid {3-[4-(4-fluoro-phenyl)-piperidin-1-yl]-propyl}-amide | CHEMBL96467 | SNAP-7915
TypeSmall organic molecule
Emp. Form.C25H28F3N3O3
Mol. Mass.475.5033
SMILESC[C@@H]1OC(=O)N([C@H]1c1ccc(F)c(F)c1)C(=O)NCCCN1CCC(CC1)c1ccc(F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: