Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin F2-alpha receptor
LigandBDBM50085910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158459
Ki 31±n/a nM
Citation Klimko PGDavis TLGriffin BWSharif NA Synthesis and biological activity of a novel 11a-homo (cyclohexyl) prostaglandin. J Med Chem 43:3400-7 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin F2-alpha receptor
Name:Prostaglandin F2-alpha receptor
Synonyms:PGF receptor | PGF2 alpha receptor | PGF2-alpha receptor | PTGFR | Prostaglandin F | Prostanoid FP receptor
Type:Enzyme
Mol. Mass.:40072.29
Organism:Homo sapiens (Human)
Description:P43088
Residue:359
Sequence:
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085910
n/a
NameBDBM50085910
Synonyms:(Z)-7-{(1R,2R,3R,5S)-2-[(E)-(R)-4-(3-Chloro-phenoxy)-3-hydroxy-but-1-enyl]-3,5-dihydroxy-cyclopentyl}-hept-5-enoic acid | 7-{2-[4-(3-Chloro-phenoxy)-3-hydroxy-but-1-enyl]-3,5-dihydroxy-cyclopentyl}-hept-5-enoic acid | CHEMBL37853 | CLOPROSTENOL
TypeSmall organic molecule
Emp. Form.C22H29ClO6
Mol. Mass.424.915
SMILESO[C@@H](COc1cccc(Cl)c1)\C=C\[C@H]1[C@H](O)C[C@H](O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: