Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAtrial natriuretic peptide receptor 3
LigandBDBM50091754
Substrate/Competitorn/a
Meas. Tech.ChEBML_34991
Ki 1.6±n/a nM
Citation Veale CAAlford VCAharony DBanville DLBialecki RABrown FJDamewood JRDantzman CLEdwards PDJacobs RTMauger RCMurphy MMPalmer WPine KKRumsey WLGarcia-Davenport LEShaw ASteelman GBSurian JMVacek EP The discovery of non-basic atrial natriuretic peptide clearance receptor antagonists. Part 1. Bioorg Med Chem Lett 10:1949-52 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Atrial natriuretic peptide receptor 3
Name:Atrial natriuretic peptide receptor 3
Synonyms:ANP-C | ANPR-C | ANPRC | Atrial natriuretic peptide C-type receptor | Atrial natriuretic peptide clearance receptor | Atrial natriuretic peptide receptor | Atrial natriuretic peptide receptor C | C5orf23 | NPR-C | NPR3
Type:PROTEIN
Mol. Mass.:59805.12
Organism:Homo sapiens (Human)
Description:ChEMBL_34991
Residue:541
Sequence:
MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLP
QDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRV
AAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPA
YAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETK
DLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDG
SWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEG
FHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLE
ESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSV
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091754
n/a
NameBDBM50091754
Synonyms:Arg-Ser-Ser-cyclic-(Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Cys)-OH | CHEMBL414293
TypeSmall organic molecule
Emp. Form.C64H106N24O20S2
Mol. Mass.1595.805
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)CNC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](CSSC[C@@H](NC(=O)[C@H](C)NC(=O)CNC1=O)C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: