Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAtrial natriuretic peptide receptor
LigandBDBM50091757
Substrate/Competitorn/a
Meas. Tech.ChEBML_34995
Ki 0.490000±n/a nM
Citation Veale CAAlford VCAharony DBanville DLBialecki RABrown FJDamewood JRDantzman CLEdwards PDJacobs RTMauger RCMurphy MMPalmer WPine KKRumsey WLGarcia-Davenport LEShaw ASteelman GBSurian JMVacek EP The discovery of non-basic atrial natriuretic peptide clearance receptor antagonists. Part 1. Bioorg Med Chem Lett 10:1949-52 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Atrial natriuretic peptide receptor
Name:Atrial natriuretic peptide receptor
Synonyms:ANP-A | ANPRA | Atrial natriuretic peptide A-type receptor | Atrial natriuretic peptide receptor A | GC-A | Guanylate cyclase | NPR-A
Type:PROTEIN
Mol. Mass.:118919.35
Organism:Homo sapiens (Human)
Description:ChEMBL_700223
Residue:1061
Sequence:
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091757
n/a
NameBDBM50091757
Synonyms:CHEMBL264744 | Cyclic-(Cys-Phe-Gly-Gly-Ala-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys)
TypeSmall organic molecule
Emp. Form.C67H107N21O22S2
Mol. Mass.1622.824
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)CNC(=O)CNC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](N)CSSC[C@@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)CNC1=O)C(O)=O)[C@@H](C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: