| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50077066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145322 (CHEMBL750410) |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Plobeck, N; Delorme, D; Wei, ZY; Yang, H; Zhou, F; Schwarz, P; Gawell, L; Gagnon, H; Pelcman, B; Schmidt, R; Yue, SY; Walpole, C; Brown, W; Zhou, E; Labarre, M; Payza, K; St-Onge, S; Kamassah, A; Morin, PE; Projean, D; Ducharme, J; Roberts, E New diarylmethylpiperazines as potent and selective nonpeptidic delta opioid receptor agonists with increased In vitro metabolic stability. J Med Chem43:3878-94 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50077066 |
|---|
| n/a |
|---|
| Name | BDBM50077066 |
|---|
| Synonyms: | 4-[(4-Allyl-piperazin-1-yl)-phenyl-methyl]-N,N-diethyl-benzamide | CHEMBL24035 | CHEMBL544641 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H33N3O |
|---|
| Mol. Mass. | 391.549 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)C(N1CCN(CC=C)CC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
