Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50092691 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145322 (CHEMBL750410) |
---|
IC50 | 1045±n/a nM |
---|
Citation | Plobeck, N; Delorme, D; Wei, ZY; Yang, H; Zhou, F; Schwarz, P; Gawell, L; Gagnon, H; Pelcman, B; Schmidt, R; Yue, SY; Walpole, C; Brown, W; Zhou, E; Labarre, M; Payza, K; St-Onge, S; Kamassah, A; Morin, PE; Projean, D; Ducharme, J; Roberts, E New diarylmethylpiperazines as potent and selective nonpeptidic delta opioid receptor agonists with increased In vitro metabolic stability. J Med Chem43:3878-94 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50092691 |
---|
n/a |
---|
Name | BDBM50092691 |
Synonyms: | 1-[4-(Phenyl-piperazin-1-yl-methyl)-phenyl]-ethanone | CHEMBL130587 |
Type | Small organic molecule |
Emp. Form. | C19H22N2O |
Mol. Mass. | 294.3908 |
SMILES | CC(=O)c1ccc(cc1)C(N1CCNCC1)c1ccccc1 |
Structure |
|