| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50092698 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145330 (CHEMBL750418) |
|---|
| IC50 | 2.6±n/a nM |
|---|
| Citation |  Wei, ZY; Brown, W; Takasaki, B; Plobeck, N; Delorme, D; Zhou, F; Yang, H; Jones, P; Gawell, L; Gagnon, H; Schmidt, R; Yue, SY; Walpole, C; Payza, K; St-Onge, S; Labarre, M; Godbout, C; Jakob, A; Butterworth, J; Kamassah, A; Morin, PE; Projean, D; Ducharme, J; Roberts, E N,N-Diethyl-4-(phenylpiperidin-4-ylidenemethyl)benzamide: a novel, exceptionally selective, potent delta opioid receptor agonist with oral bioavailability and its analogues. J Med Chem43:3895-905 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50092698 |
|---|
| n/a |
|---|
| Name | BDBM50092698 |
|---|
| Synonyms: | 4-[(3-Amino-phenyl)-piperidin-4-ylidene-methyl]-N,N-diethyl-benzamide | CHEMBL127495 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29N3O |
|---|
| Mol. Mass. | 363.4959 |
|---|
| SMILES | [#6]-[#6]-[#7](-[#6]-[#6])-[#6](=O)-c1ccc(cc1)-[#6](=[#6]-1\[#6]-[#6]-[#7]-[#6]-[#6]-1)\c1cccc(-[#7])c1 |
|---|
| Structure | 
|
|---|
Search and Browse
