Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranscription factor AP-1
LigandBDBM50062648
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28876
IC50 50±n/a nM
Citation Palanki MSErdman PEGayo-Fung LMShevlin GISullivan RWGoldman MERansone LJBennett BLManning AMSuto MJ Inhibitors of NF-kappaB and AP-1 gene expression: SAR studies on the pyrimidine portion of 2-chloro-4-trifluoromethylpyrimidine-5-[N-(3', 5'-bis(trifluoromethyl)phenyl)carboxamide]. J Med Chem 43:3995-4004 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Transcription factor AP-1
Name:Transcription factor AP-1
Synonyms:AP1 | Activator protein 1 | JUN | Proto-oncogene c-JUN | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39
Type:n/a
Mol. Mass.:35683.24
Organism:Homo sapiens (Human)
Description:P05412
Residue:331
Sequence:
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062648
n/a
NameBDBM50062648
Synonyms:2-Chloro-4-trifluoromethyl-pyrimidine-5-carboxylic acid (3,5-bis-trifluoromethyl-phenyl)-amide | CHEMBL336546
TypeSmall organic molecule
Emp. Form.C14H5ClF9N3O
Mol. Mass.437.648
SMILESFC(F)(F)c1cc(NC(=O)c2cnc(Cl)nc2C(F)(F)F)cc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: