Reaction Details |
| Report a problem with these data |
Target | Transcription factor Jun |
---|
Ligand | BDBM50092886 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_28876 (CHEMBL645946) |
---|
IC50 | 8000±n/a nM |
---|
Citation | Palanki, MS; Erdman, PE; Gayo-Fung, LM; Shevlin, GI; Sullivan, RW; Goldman, ME; Ransone, LJ; Bennett, BL; Manning, AM; Suto, MJ Inhibitors of NF-kappaB and AP-1 gene expression: SAR studies on the pyrimidine portion of 2-chloro-4-trifluoromethylpyrimidine-5-[N-(3', 5'-bis(trifluoromethyl)phenyl)carboxamide]. J Med Chem43:3995-4004 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Transcription factor Jun |
---|
Name: | Transcription factor Jun |
Synonyms: | AP1 | Activator protein 1 | JUN | JUN_HUMAN | Proto-oncogene c-JUN | Transcription factor AP-1 | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39 |
Type: | n/a |
Mol. Mass.: | 35683.24 |
Organism: | Homo sapiens (Human) |
Description: | P05412 |
Residue: | 331 |
Sequence: | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
|
|
|
BDBM50092886 |
---|
n/a |
---|
Name | BDBM50092886 |
Synonyms: | 2-Chloro-4-thiophen-2-yl-pyrimidine-5-carboxylic acid (3,5-bis-trifluoromethyl-phenyl)-amide | CHEMBL128599 |
Type | Small organic molecule |
Emp. Form. | C17H8ClF6N3OS |
Mol. Mass. | 451.773 |
SMILES | FC(F)(F)c1cc(NC(=O)c2cnc(Cl)nc2-c2cccs2)cc(c1)C(F)(F)F |
Structure |
|