Reaction Details |
| Report a problem with these data |
Target | Tryptase beta-2 |
---|
Ligand | BDBM50093132 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_210829 |
---|
Ki | 2±n/a nM |
---|
Citation | Rice, KD; Gangloff, AR; Kuo, EY; Dener, JM; Wang, VR; Lum, R; Newcomb, WS; Havel, C; Putnam, D; Cregar, L; Wong, M; Warne, RL Dibasic inhibitors of human mast cell tryptase. Part 1: synthesis and optimization of a novel class of inhibitors. Bioorg Med Chem Lett10:2357-60 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tryptase beta-2 |
---|
Name: | Tryptase beta-2 |
Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
Type: | PROTEIN |
Mol. Mass.: | 30518.79 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_210702 |
Residue: | 275 |
Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
BDBM50093132 |
---|
n/a |
---|
Name | BDBM50093132 |
Synonyms: | CHEMBL75749 | [3-(4-Guanidino-benzyl)-ureido]-acetic acid 5-{2-[3-(4-guanidino-benzyl)-ureido]-acetoxy}-cyclooctyl ester |
Type | Small organic molecule |
Emp. Form. | C30H42N10O6 |
Mol. Mass. | 638.7179 |
SMILES | [#7]\[#6](-[#7])=[#7]/c1ccc(-[#6]-[#7]-[#6](=O)-[#7]-[#6]-[#6](=O)-[#8]-[#6@H]-2-[#6]-[#6]-[#6]-[#6@H](-[#6]-[#6]-[#6]-2)-[#8]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#7]-[#6]-c2ccc(cc2)\[#7]=[#6](\[#7])-[#7])cc1 |
Structure |
|