Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLDL-associated phospholipase A2
LigandBDBM50093924
Substrate/Competitorn/a
Meas. Tech.ChEBML_101010
IC50 11±n/a nM
Citation Boyd HFFell SCFlynn STHickey DMIfe RJLeach CAMacphee CHMilliner KJMoores KEPinto ILPorter RARawlings DASmith SAStansfield IGTew DGTheobald CJWhittaker CM N-1 substituted pyrimidin-4-ones: novel, orally active inhibitors of lipoprotein-associated phospholipase A2. Bioorg Med Chem Lett 10:2557-61 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LDL-associated phospholipase A2
Name:LDL-associated phospholipase A2
Synonyms:1-alkyl-2-acetylglycerophosphocholine esterase | 2-acetyl-1-alkylglycerophosphocholine esterase | LDL-PLA(2) | PAF 2-acylhydrolase | PAF acetylhydrolase | Platelet-activating factor acetylhydrolase
Type:PROTEIN
Mol. Mass.:50084.41
Organism:Homo sapiens (Human)
Description:ChEMBL_156212
Residue:441
Sequence:
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50093924
n/a
NameBDBM50093924
Synonyms:2-[8-(4-Chloro-phenyl)-8-oxo-octylsulfanyl]-5-pyrimidin-5-ylmethyl-1-thiophen-2-ylmethyl-1H-pyrimidin-4-one | CHEMBL85805
TypeSmall organic molecule
Emp. Form.C28H29ClN4O2S2
Mol. Mass.553.138
SMILESClc1ccc(cc1)C(=O)CCCCCCCSc1nc(=O)c(Cc2cncnc2)cn1Cc1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: