Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50095047
Substrate/Competitorn/a
Meas. Tech.ChEBML_60046
Ki 290±n/a nM
Citation Stevenson GISmith ALLewis SMichie SGNeduvelil JGPatel SMarwood RPatel SCastro JL 2-Aryl tryptamines: selective high-affinity antagonists for the h5-HT2A receptor. Bioorg Med Chem Lett 10:2697-9 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095047
n/a
NameBDBM50095047
Synonyms:3-[2-((S)-2-Methyl-piperidin-1-yl)-ethyl]-2-phenyl-1H-indole | CHEMBL90739
TypeSmall organic molecule
Emp. Form.C22H26N2
Mol. Mass.318.4552
SMILESC[C@H]1CCCCN1CCc1c([nH]c2ccccc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: