Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM50096651
Substrate/Competitorn/a
Meas. Tech.ChEBML_104377
IC50 0.400000±n/a nM
Citation Chollet AMLe Diguarher TMurray LBertrand MTucker GCSabatini MPierré AAtassi GBonnet JCasara P General synthesis of alpha-substituted 3-bisaryloxy propionic acid derivatives as specific MMP inhibitors. Bioorg Med Chem Lett 11:295-9 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase 2/9
Synonyms:72 kDa gelatinase | 72 kDa type IV collagenase precursor | Gelatinase A | Gelatinase A (MMP-2) | Matrix metalloproteinase-2 | Matrix metalloproteinase-2 (MMP 2) | Matrix metalloproteinase-2 (MMP2) | Matrix metalloproteinases 2 (MMP-2) | TBE-1
Type:Enzyme
Mol. Mass.:73870.36
Organism:Homo sapiens (Human)
Description:
Residue:660
Sequence:
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096651
n/a
NameBDBM50096651
Synonyms:2-(4'-Cyano-biphenyl-4-yloxymethyl)-N-hydroxy-4-(4-oxo-4H-benzo[d][1,2,3]triazin-3-yl)-butyramide | CHEMBL317508
TypeSmall organic molecule
Emp. Form.C25H21N5O4
Mol. Mass.455.4653
SMILESONC(=O)C(CCn1nnc2ccccc2c1=O)COc1ccc(cc1)-c1ccc(cc1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: