Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStromelysin-1
LigandBDBM50096651
Substrate/Competitorn/a
Meas. Tech.ChEBML_104720
IC50 1.1±n/a nM
Citation Chollet AMLe Diguarher TMurray LBertrand MTucker GCSabatini MPierré AAtassi GBonnet JCasara P General synthesis of alpha-substituted 3-bisaryloxy propionic acid derivatives as specific MMP inhibitors. Bioorg Med Chem Lett 11:295-9 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Stromelysin-1
Name:Matrix metalloproteinase (2 and 3)
Synonyms:MMP-3 | Matrix metalloproteinase 3 | Matrix metalloproteinase-3 | Matrix metalloproteinase-3 (MMP-3) | Matrix metalloproteinase-3 (MMP3) | SL-1 | Stromelysin 1 | Transin-1
Type:Enzyme
Mol. Mass.:53973.13
Organism:Homo sapiens (Human)
Description:
Residue:477
Sequence:
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096651
n/a
NameBDBM50096651
Synonyms:2-(4'-Cyano-biphenyl-4-yloxymethyl)-N-hydroxy-4-(4-oxo-4H-benzo[d][1,2,3]triazin-3-yl)-butyramide | CHEMBL317508
TypeSmall organic molecule
Emp. Form.C25H21N5O4
Mol. Mass.455.4653
SMILESONC(=O)C(CCn1nnc2ccccc2c1=O)COc1ccc(cc1)-c1ccc(cc1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: