| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50096721 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_51283 |
|---|
| Ki | 3±n/a nM |
|---|
| Citation |  Tian, X; Hsin, LW; Webster, EL; Contoreggi, C; Chrousos, GP; Gold, PW; Habib, K; Ayala, A; Eckelman, WC; Jacobson, AE; Rice, KC The development of a potential single photon emission computed tomography (SPECT) imaging agent for the corticotropin-releasing hormone receptor type. Bioorg Med Chem Lett11:331-3 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 47870.75 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Receptor binding assays were performed using rat cortex homogenate. |
|---|
| Residue: | 415 |
|---|
| Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50096721 |
|---|
| n/a |
|---|
| Name | BDBM50096721 |
|---|
| Synonyms: | 5-Chloro-N-cyclopropylmethyl-N'-(2,6-dichloro-4-tributylstannanyl-phenyl)-2-methyl-N-propyl-pyrimidine-4,6-diamine | CHEMBL115836 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H47Cl3N4Sn |
|---|
| Mol. Mass. | 688.79 |
|---|
| SMILES | CCCC[Sn](CCCC)(CCCC)c1cc(Cl)c(Nc2nc(C)nc(N(CCC)CC3CC3)c2Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
