Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, PKC; classical/novel
LigandBDBM50057512
Substrate/Competitorn/a
Meas. Tech.ChEMBL_161136
Ki 10±n/a nM
Citation Tanaka MIrie KNakagawa YNakamura YOhigashi HWender PA The C4 hydroxyl group of phorbol esters is not necessary for protein kinase C binding. Bioorg Med Chem Lett 11:719-22 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, PKC; classical/novel
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC-L | nPKC-eta
Type:Enzyme
Mol. Mass.:77844.26
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:683
Sequence:
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50057512
n/a
NameBDBM50057512
Synonyms:(1aR,1bS,4aR,7aS,7bS,8R,9R,9aS)-4a,7b-dihydroxy-3-(hydroxymethyl)-1,1,6,8-tetramethyl-5-oxo-1,1a,1b,4,4a,5,7a,7b,8,9-decahydro-9aH-cyclopropa[3,4]benzo[1,2-e]azulene-9,9a-diyl dibutanoate | CHEMBL27768 | PDBu | phorbol 12,13-dibutanoate | phorbol 12,13-dibutyrate
TypeSmall organic molecule
Emp. Form.C28H40O8
Mol. Mass.504.6124
SMILESCCCC(=O)O[C@@H]1[C@@H](C)[C@]2(O)[C@@H]3C=C(C)C(=O)[C@@]3(O)CC(CO)=C[C@H]2[C@@H]2C(C)(C)[C@]12OC(=O)CCC |c:23,t:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: