Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPKC alpha and beta-2
LigandBDBM50097750
Substrate/Competitorn/a
Meas. Tech.ChEMBL_160436
Ki 4.1±n/a nM
Citation Tanaka MIrie KNakagawa YNakamura YOhigashi HWender PA The C4 hydroxyl group of phorbol esters is not necessary for protein kinase C binding. Bioorg Med Chem Lett 11:719-22 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
PKC alpha and beta-2
Name:PKC alpha and beta-2
Synonyms:PKC alpha | PKC-A | PKC-alpha | Protein Kinase C- alpha | Protein kinase C alpha | Protein kinase C alpha (PKCa) | Protein kinase C alpha type (PKC-A) | Protein kinase C alpha type (PRKCA) | Proto-oncogene c-RAF | RAF proto-oncogene serine/threonine-protein kinase
Type:Enzyme
Mol. Mass.:76755.65
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:672
Sequence:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097750
n/a
NameBDBM50097750
Synonyms:Butyric acid (1aR,1bS,4aS,7aR,7bR,8R,9R,9aS)-9-butyryloxy-7b-hydroxy-3-hydroxymethyl-1,1,6,8-tetramethyl-5-oxo-1,1a,1b,4,4a,5,7a,7b,8,9-decahydro-cyclopropa[3,4]benzo[1,2-e]azulen-9a-yl ester | CHEMBL265998
TypeSmall organic molecule
Emp. Form.C28H40O7
Mol. Mass.488.613
SMILESCCCC(=O)O[C@@H]1[C@@H](C)[C@]2(O)[C@@H]3C=C(C)C(=O)[C@H]3CC(CO)=C[C@H]2[C@@H]2C(C)(C)[C@]12OC(=O)CCC |c:22,t:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: