Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM22915
Substrate/Competitorn/a
Meas. Tech.ChEBML_83643
Ki 2.7±n/a nM
Citation Stark HSippl WLigneau XArrang JMGanellin CRSchwartz JCSchunack W Different antagonist binding properties of human and rat histamine H3 receptors. Bioorg Med Chem Lett 11:951-4 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22915
n/a
NameBDBM22915
Synonyms:3-(1H-imidazol-4-yl)propylphenylmethyl ether | 5-[3-(benzyloxy)propyl]-1H-imidazole | CHEMBL61618 | PROXYFAN | Proxyfan
TypeSmall organic molecule
Emp. Form.C13H16N2O
Mol. Mass.216.2789
SMILESC(COCc1ccccc1)Cc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: