Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntercellular adhesion molecule (ICAM-1), Integrin alpha-L/beta-2
LigandBDBM50098480
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89064
IC50 10±n/a nM
Citation Stewart AOBhatia PAMcCarty CMPatel MVStaeger MAArendsen DLGunawardana IWMelcher LMZhu GDBoyd SAFry DGCool BLKifle LLartey KMarsh KCKempf-Grote AJKilgannon PWisdom WMeyer JGallatin WMOkasinski GF Discovery of inhibitors of cell adhesion molecule expression in human endothelial cells. 1. Selective inhibition of ICAM-1 and E-selectin expression. J Med Chem 44:988-1002 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Intercellular adhesion molecule (ICAM-1), Integrin alpha-L/beta-2
Name:Intercellular adhesion molecule (ICAM-1), Integrin alpha-L/beta-2
Synonyms:CD_antigen=CD54 | ICAM-1 | Intercellular adhesion molecule 1 | Intercellular adhesion molecule-1 | Major group rhinovirus receptor
Type:PROTEIN
Mol. Mass.:57831.10
Organism:Homo sapiens (Human)
Description:ChEMBL_826675
Residue:532
Sequence:
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098480
n/a
NameBDBM50098480
Synonyms:4-(4-Bromo-phenylsulfanyl)-thieno[2,3-c]pyridine-2-carboxylic acid amide | CHEMBL266198
TypeSmall organic molecule
Emp. Form.C14H9BrN2OS2
Mol. Mass.365.268
SMILESNC(=O)c1cc2c(Sc3ccc(Br)cc3)cncc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: