Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVCAM-1
LigandBDBM50098480
Substrate/Competitorn/a
Meas. Tech.ChEMBL_213817
IC50>4000±n/a nM
Citation Stewart AOBhatia PAMcCarty CMPatel MVStaeger MAArendsen DLGunawardana IWMelcher LMZhu GDBoyd SAFry DGCool BLKifle LLartey KMarsh KCKempf-Grote AJKilgannon PWisdom WMeyer JGallatin WMOkasinski GF Discovery of inhibitors of cell adhesion molecule expression in human endothelial cells. 1. Selective inhibition of ICAM-1 and E-selectin expression. J Med Chem 44:988-1002 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
VCAM-1
Name:Vascular cell adhesion protein 1
Synonyms:CD106 antigen | INCAM-100 | Vascular cell adhesion protein 1 | Vascular cell adhesion protein 1 (VCAM-1) | Vascular cell adhesion protein 1 precursor
Type:Other Protein Type
Mol. Mass.:81259.16
Organism:Homo sapiens (Human)
Description:P19320
Residue:739
Sequence:
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098480
n/a
NameBDBM50098480
Synonyms:4-(4-Bromo-phenylsulfanyl)-thieno[2,3-c]pyridine-2-carboxylic acid amide | CHEMBL266198
TypeSmall organic molecule
Emp. Form.C14H9BrN2OS2
Mol. Mass.365.268
SMILESNC(=O)c1cc2c(Sc3ccc(Br)cc3)cncc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: