Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 1
LigandBDBM50098624
Substrate/Competitorn/a
Meas. Tech.ChEMBL_218696
IC50 21±n/a nM
Citation Naya ASagara YOhwaki KSaeki TIchikawa DIwasawa YNoguchi KOhtake N Design, synthesis, and discovery of a novel CCR1 antagonist. J Med Chem 44:1429-35 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 1
Name:C-C chemokine receptor type 1
Synonyms:C-C CKR-1 | CC-CKR-1 | CCR-1 | CCR1 | CD_antigen=CD191 | MIP-1alpha-R | Macrophage inflammatory protein 1-alpha receptor | RANTES-R
Type:PROTEIN
Mol. Mass.:40904.59
Organism:Mus musculus
Description:ChEMBL_1452291
Residue:355
Sequence:
MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLM
QHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTH
RTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRL
IFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPII
YVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098624
n/a
NameBDBM50098624
Synonyms:1-Cyclooct-1-enylmethyl-4-[(2,7-dichloro-9H-xanthene-9-carbonyl)-amino]-1-ethyl-piperidinium; iodide | CHEMBL34626
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: