Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50099479
Substrate/Competitorn/a
Meas. Tech.ChEBML_40365
IC50 20±n/a nM
Citation Naya AKobayashi KIshikawa MOhwaki KSaeki TNoguchi KOhtake N Discovery of a novel CCR3 selective antagonist. Bioorg Med Chem Lett 11:1219-23 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | C-C chemokine receptor type 3 (CCR3) | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | Eosinophil eotaxin receptor
Type:Enzyme
Mol. Mass.:41053.88
Organism:Homo sapiens (Human)
Description:P51677
Residue:355
Sequence:
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099479
n/a
NameBDBM50099479
Synonyms:CHEMBL21143 | N-[1-(3,4-Dichloro-benzyl)-piperidin-4-yl]-2-(6-ethoxy-benzothiazol-2-ylsulfanyl)-acetamide
TypeSmall organic molecule
Emp. Form.C23H25Cl2N3O2S2
Mol. Mass.510.5
SMILESCCOc1ccc2nc(SCC(=O)NC3CCN(Cc4ccc(Cl)c(Cl)c4)CC3)sc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: