Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuromedin-K receptor
LigandBDBM50099633
Substrate/Competitorn/a
Meas. Tech.ChEMBL_220885
Ki 2.2±n/a nM
Citation Blaney FERaveglia LFArtico MCavagnera SDartois CFarina CGrugni MGagliardi SLuttmann MAMartinelli MNadler GMParini CPetrillo PSarau HMScheideler MAHay DWGiardina GA Stepwise modulation of neurokinin-3 and neurokinin-2 receptor affinity and selectivity in quinoline tachykinin receptor antagonists. J Med Chem 44:1675-89 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuromedin-K receptor
Name:Neuromedin-K receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin 3 receptor | Neurokinin B receptor | Neurokinin-3 (NK-3) | Neuromedin-3 receptor (NK-3R) | Neuromedin-3 receptor (NK3) | Neuromedin-K receptor (NK3) | Tachykinin receptor 3 | Tachykinin receptor 3 (NK3)
Type:Enzyme
Mol. Mass.:52221.96
Organism:Homo sapiens (Human)
Description:P29371
Residue:465
Sequence:
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099633
n/a
NameBDBM50099633
Synonyms:3-Dimethylaminomethyl-2-phenyl-quinoline-4-carboxylic acid (1-phenyl-propyl)-amide | CHEMBL44722
TypeSmall organic molecule
Emp. Form.C28H29N3O
Mol. Mass.423.5494
SMILESCC[C@H](NC(=O)c1c(CN(C)C)c(nc2ccccc12)-c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: