Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSubstance-K receptor
LigandBDBM50099642
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209033
Ki 9.2±n/a nM
Citation Blaney FERaveglia LFArtico MCavagnera SDartois CFarina CGrugni MGagliardi SLuttmann MAMartinelli MNadler GMParini CPetrillo PSarau HMScheideler MAHay DWGiardina GA Stepwise modulation of neurokinin-3 and neurokinin-2 receptor affinity and selectivity in quinoline tachykinin receptor antagonists. J Med Chem 44:1675-89 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Substance-K receptor
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2)
Type:Protein
Mol. Mass.:44455.78
Organism:Homo sapiens (Human)
Description:P21452
Residue:398
Sequence:
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099642
n/a
NameBDBM50099642
Synonyms:3-(4-Isopropyl-piperazin-1-ylmethyl)-2-phenyl-quinoline-4-carboxylic acid (1,2-dimethyl-propyl)-amide | CHEMBL296122
TypeSmall organic molecule
Emp. Form.C29H38N4O
Mol. Mass.458.6382
SMILESCC(C)C(C)NC(=O)c1c(CN2CCN(CC2)C(C)C)c(nc2ccccc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: