Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50101269
Substrate/Competitorn/a
Meas. Tech.ChEBML_65627
IC50 120±n/a nM
Citation Kukkola PJBilci NAIkler TSavage PShetty SSDelGrande DJeng AY Isoindolines: a new series of potent and selective endothelin-A receptor antagonists. Bioorg Med Chem Lett 11:1737-40 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin-1 receptor
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101269
n/a
NameBDBM50101269
Synonyms:CHEMBL298922 | [(1R,3R)-1-Benzo[1,3]dioxol-5-yl-3-(4-methoxy-phenyl)-5-propoxy-1,3-dihydro-isoindol-2-yl]-acetic acid
TypeSmall organic molecule
Emp. Form.C27H27NO6
Mol. Mass.461.5064
SMILESCCCOc1ccc2[C@H](N(CC(O)=O)[C@@H](c2c1)c1ccc(OC)cc1)c1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: