Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 1B
LigandBDBM50101590
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46323
IC50 83200±n/a nM
Citation Giannessi FChiodi PMarzi MMinetti PPessotto PDe Angelis FTassoni EConti RGiorgi FMabilia MDell'Uomo NMuck STinti MOCarminati PArduini A Reversible carnitine palmitoyltransferase inhibitors with broad chemical diversity as potential antidiabetic agents. J Med Chem 44:2383-6 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 1B
Name:Carnitine palmitoyltransferase 1B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:88241.28
Organism:Rattus norvegicus
Description:ChEMBL_887447
Residue:772
Sequence:
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSNYCKVDISMGLVHCIQRCLPTRYGSYGTPQTETLLSMVIFSTGVWATG
IFLFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEAYFRMESLAKEFQDKIAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRSPIMVNSNYYAMDFVLIKNTSQQAARLGNTVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSCLLKPRDL
EMQFQRILDDTSPPQPGEEKLAALTAGGRVEWAEARQKFFSSGKNKMSLDTIERAAFFVA
LDEDSHCYNPDDEASLSLYGKSLLHGNCYNRWFDKSFTLISCKNGQLGLNTEHSWADAPI
IGHLWEFVLATDTFHLGYTETGHCVGEPNTKLPPPQRMQWDIPEQCQTAIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVRAMMTGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YIVSKYLGVRSPFLDEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADHGY
GVSYMIAGENTMFFHVSSKLSSSETNALRFGNHIRQALLDIADLFKISKTDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101590
n/a
NameBDBM50101590
Synonyms:CHEMBL78921 | [3-Carboxy-2-(3-nonyl-ureido)-propyl]-trimethyl-ammonium
TypeSmall organic molecule
Emp. Form.C17H35N3O3
Mol. Mass.329.4781
SMILESCCCCCCCCCNC(=O)NC(CC([O-])=O)C[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: