Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP3 Receptor
LigandBDBM50101832
Substrate/Competitorn/a
Meas. Tech.ChEBML_158323
Ki>0.000100±n/a nM
Citation Tani KNaganawa AIshida AEgashira HSagawa KHarada HOgawa MMaruyama TOhuchida SNakai HKondo KToda M Design and synthesis of a highly selective EP2-receptor agonist. Bioorg Med Chem Lett 11:2025-8 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP3 Receptor
Name:Prostanoid EP3 receptor
Synonyms:PGE receptor, EP3 isoform alpha | PTGER3 | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3
Type:G-protein coupled receptor
Mol. Mass.:40092.50
Organism:Mus musculus (Mouse)
Description:n/a
Residue:365
Sequence:
MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101832
n/a
NameBDBM50101832
Synonyms:(E)-7-{(1R,3R)-3-Hydroxy-2-[(E)-(S)-4-hydroxy-4-(1-propyl-cyclobutyl)-but-1-enyl]-5-oxo-cyclopentyl}-hept-5-enoic acid | CHEMBL293242
TypeSmall organic molecule
Emp. Form.C23H36O5
Mol. Mass.392.5289
SMILESCCCC1(CCC1)[C@@H](O)C\C=C\C1[C@H](O)CC(=O)[C@@H]1C\C=C\CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: