Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP4 Receptor
LigandBDBM50101822
Substrate/Competitorn/a
Meas. Tech.ChEBML_158449
Ki 3.1±n/a nM
Citation Tani KNaganawa AIshida AEgashira HSagawa KHarada HOgawa MMaruyama TOhuchida SNakai HKondo KToda M Design and synthesis of a highly selective EP2-receptor agonist. Bioorg Med Chem Lett 11:2025-8 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP4 Receptor
Name:Prostanoid EP4 receptor
Synonyms:PGE receptor, EP4 subtype
Type:G-protein coupled receptor
Mol. Mass.:56175.66
Organism:Mus musculus (Mouse)
Description:n/a
Residue:513
Sequence:
MAEVGGTIPRSNRELQRCVLLTTTIMSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGN
LVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYS
TFILLFFGLSGLSIICAMSIERYLAINHAYFYSHYVDKRLAGLTLFAIYASNVLFCALPN
MGLGRSERQYPGTWCFIDWTTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHR
QFMRRTSLGTEQHHAAAAAAVASVACRGHAGASPALQRLSDFRRRRSFRRIAGAEIQMVI
LLIATSLVVLICSIPLVVRVFINQLYQPNVVKDISRNPDLQAIRIASVNPILDPWIYILL
RKTVLSKAIEKIKCLFCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTS
QTLLYLPDLTESSLGGRNLLPGSHGMGLTQADTTSLRTLRISETSDSSQGQDSESVLLVD
EVSGSHREEPASKGNSLQVTFPSETLKLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101822
n/a
NameBDBM50101822
Synonyms:(Z)-7-[(1R,2R,3R)-3-Hydroxy-2-((E)-(R)-3-hydroxy-oct-1-enyl)-5-oxo-cyclopentyl]-hept-5-enoic acid | CHEMBL64804 | PGE2, 15-epi | US9180116, PGE2
TypeSmall organic molecule
Emp. Form.C20H32O5
Mol. Mass.352.4651
SMILESCCCCC[C@@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: