Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP2 Receptor
LigandBDBM50101830
Substrate/Competitorn/a
Meas. Tech.ChEBML_158309
Ki 2.2±n/a nM
Citation Tani KNaganawa AIshida AEgashira HSagawa KHarada HOgawa MMaruyama TOhuchida SNakai HKondo KToda M Design and synthesis of a highly selective EP2-receptor agonist. Bioorg Med Chem Lett 11:2025-8 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP2 Receptor
Name:Prostanoid EP2 receptor
Synonyms:PGE receptor, EP2 subtype | Prostaglandin E2 | Prostaglandin E2 receptor EP2 subtype
Type:G-protein coupled receptor
Mol. Mass.:40495.26
Organism:Mus musculus (Mouse)
Description:n/a
Residue:362
Sequence:
MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAG
SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFF
SLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYV
QYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGS
SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRA
LRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCG
QL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101830
n/a
NameBDBM50101830
Synonyms:(Z)-7-{(1R,2R,3R,5R)-5-Chloro-2-[(E)-(S)-4-(1-ethyl-cyclobutyl)-4-hydroxy-but-1-enyl]-3-hydroxy-cyclopentyl}-hept-5-enoic acid | CHEMBL64246
TypeSmall organic molecule
Emp. Form.C22H35ClO4
Mol. Mass.398.964
SMILESCCC1(CCC1)[C@@H](O)C\C=C\[C@H]1[C@H](O)C[C@@H](Cl)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: